TBLASTN 1.3.9 [29-Oct-93] Reference: Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J. Lipman (1990). Basic local alignment search tool. J. Mol. Biol. 215:403-410. Notice: statistical significance is estimated under the assumption that the equivalent of one complete reading frame of the database codes for protein and that significant alignments will involve only coding reading frames. Query= D09_orf127a.prot 127 bases, CA4A80B8 checksum. (127 letters) Database: MGseq 1 sequences; 580,073 total letters. Searchingdone Smallest Poisson Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N Mycoplasma genitalium 580073 bp 10/09/95 +2 383 3.9e-50 1 >Mycoplasma genitalium 580073 bp 10/09/95 Length = 580,073 Plus Strand HSPs: Score = 51 (23.9 bits), Expect = 0.27, P = 0.23 Identities = 8/28 (28%), Positives = 21/28 (75%), Frame = +2 Query: 59 LIVLGVLEILLMVAQLVMSNMAANIINE 86 + +L + ++LMV +L++S + +N++N+ Sbjct: 111632 IAILFITRLMLMVRKLMLSLILSNLVNK 111715 Score = 46 (21.6 bits), Expect = 0.42, Poisson P(2) = 0.34 Identities = 14/62 (22%), Positives = 25/62 (40%), Frame = +1 Query: 14 TMLVCIFFFVCTISLIGIGIMYDLINRTSLSAPRRDPIFRNLNTVLIVLGVLEILLMVAQ 73 T + C F F ++ YDL + P + +F N I+ V + +M+A Sbjct: 107905 TRVSCSFSFNSEPEILFANSCYDLQQMPQIIKPF*EKLFNEQNYQKIIDSVSRLNVMIAN 108084 Query: 74 LV 75 + Sbjct: 108085 YI 108090 Score = 44 (20.7 bits), Expect = 0.42, Poisson P(3) = 0.35 Identities = 7/19 (36%), Positives = 12/19 (63%), Frame = +3 Query: 2 KVIKKLNLLNELTMLVCIF 20 K L +NELT ++C++ Sbjct: 80370 KASNSLRCINELTSILCLY 80426 Score = 43 (20.2 bits), Expect = 0.27, Poisson P(4) = 0.24 Identities = 9/16 (56%), Positives = 10/16 (62%), Frame = +2 Query: 91 VEQKFAKALKWSRFLP 106 VEQ+ K W RFLP Sbjct: 306755 VEQQSPKLSVWVRFLP 306802 Score = 42 (19.7 bits), Expect = 1.9, P = 0.85 Identities = 8/17 (47%), Positives = 12/17 (70%), Frame = +2 Query: 105 LPFGLLQLYCYHKIKLV 121 +PF ++ L CYH + LV Sbjct: 71429 VPF*VVFLTCYHSLFLV 71479 Score = 42 (19.7 bits), Expect = 2.5, Poisson P(2) = 0.92 Identities = 9/20 (45%), Positives = 11/20 (55%), Frame = +2 Query: 8 NLLNELTMLVCIFFFVCTIS 27 NL+ +L CIFF IS Sbjct: 416078 NLITKLANFSCIFFTTMDIS 416137 Score = 41 (19.3 bits), Expect = 3.2, Poisson P(2) = 0.96 Identities = 8/20 (40%), Positives = 13/20 (65%), Frame = +2 Query: 7 LNLLNELTMLVCIFFFVCTI 26 +N+++ L+CIFF TI Sbjct: 524942 INVVSTNYFLICIFFNTFTI 525001 Score = 40 (18.8 bits), Expect = 4.7, Poisson P(4) = 0.99 Identities = 9/20 (45%), Positives = 11/20 (55%), Frame = +3 Query: 107 FGLLQLYCYHKIKLVTQTDN 126 FGLL L+ K K + Q N Sbjct: 156258 FGLLYLWIVKKSKQIAQQPN 156317 Minus Strand HSPs: Score = 383 (179.9 bits), Expect = 3.9e-50, P = 3.9e-50 Identities = 80/127 (62%), Positives = 92/127 (72%), Frame = -3 Query: 1 MKVIKKLNLLNELTMLVCIFFFVCTISLIGIGIMYDLINRTSLSAPRRDPIFRNLNTVLI 60 MKV KKL+ LNE+ +L+ IFF VC ISL+GIGI++DLI + SLSA R DPIF NL VLI Sbjct: 64911 MKVFKKLHNLNEILLLISIFFLVCIISLVGIGIIFDLIRKASLSAIRSDPIFFNLRAVLI 64732 Query: 61 VLGVLEILLMVAQLVMSNMAANIINEVAENVEQKFAKALKWSRFLPFGLLQLYCYHKIKL 120 VLGV I M+ QLV+S M IN EN+E KF K L S FLPFGLLQLYCY KIKL Sbjct: 64731 VLGVFAICFMIIQLVISIMI*KTINTACENIEPKFKKILH*SCFLPFGLLQLYCYQKIKL 64552 Query: 121 VTQTDNI 127 V Q DN+ Sbjct: 64551 VKQADNL 64531 Parameters: E = 5.0, S = 43 (20.2 bits), E2 = 0.12, S2 = 35 W = 3, T = 13 (6.1 bits), X = 22 (10.3 bits) M = BLOSUM62 C = 0 (Standard genetic code) H = 0, V = 500, B = 250 -gapdecayrate 0.5 (the default) Statistics: Lambda = 0.326, Lambda/ln2 = 0.470, K = 0.142, H = 0.567 bits/position Expected/Observed high score = 45 (21.1 bits) / 383 (179.9 bits) # of letters in query: 127 aa # of neighborhood words in query: 761 # of exact words scoring below T: 8 Database: MGseq # of letters in database: 580,073 bp # of word hits against database: 85,509 # of failed hit extensions: 74,022 # of successful extensions: 353 # of overlapping HSPs discarded: 344 # of HSPs reportable: 9 # of sequences in database: 1 # of db sequences with at least one HSP: 1 No. of states in DFA: 339 (34 KB) Total size of DFA: 43 KB (64 KB) Time to generate neighborhood: 0.00u 0.01s 0.01t Real: 00:00:00 No. of processors used: 1 Time to search database: 1.65u 0.03s 1.68t Real: 00:00:03 Total cpu time: 1.68u 0.18s 1.86t Real: 00:00:03