TBLASTN 1.3.9 [29-Oct-93] Reference: Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J. Lipman (1990). Basic local alignment search tool. J. Mol. Biol. 215:403-410. Notice: statistical significance is estimated under the assumption that the equivalent of one complete reading frame of the database codes for protein and that significant alignments will involve only coding reading frames. Query= H10_orf119.prot 119 bases, 933622F4 checksum. (119 letters) Database: MGseq 1 sequences; 580,073 total letters. Searchingdone Smallest Poisson Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N Mycoplasma genitalium 580073 bp 10/09/95 +1 215 9.2e-26 1 >Mycoplasma genitalium 580073 bp 10/09/95 Length = 580,073 Plus Strand HSPs: Score = 215 (98.8 bits), Expect = 9.2e-26, P = 9.2e-26 Identities = 41/70 (58%), Positives = 58/70 (82%), Frame = +1 Query: 45 DSEKSSFLAVHWSLKEAIYKAVNHIKPLFSQLEITKKNQRYNCQIDPKIELLLSVSYSSN 104 ++++++FLAVH +LKEAIYKA +HIKPLF++LEI K N +Y C+ I LLLSVSY++ Sbjct: 251569 NNQRANFLAVH*TLKEAIYKATSHIKPLFTKLEIYKLNNQYRCEFIQNINLLLSVSYTNC 251748 Query: 105 NITAICLAQQ 114 +++AICLAQQ Sbjct: 251749 HVSAICLAQQ 251778 Score = 68 (31.3 bits), Expect = 3.8e-07, Poisson P(2) = 3.8e-07 Identities = 14/25 (56%), Positives = 17/25 (68%), Frame = +1 Query: 21 QTDNCFAKRLLTSTEYAHYAKLRKD 45 +T +CFAKRLLTS E Y KL + Sbjct: 251500 ETSDCFAKRLLTSNELNSY*KLNNN 251574 Score = 66 (30.3 bits), Expect = 3.8e-10, Poisson P(3) = 3.8e-10 Identities = 12/23 (52%), Positives = 18/23 (78%), Frame = +1 Query: 1 MILGIGIDLVEIKRFEQLARQTD 23 M++GIGID+V++KRF L +D Sbjct: 251443 MVVGIGIDVVQLKRFLTLVETSD 251511 Score = 46 (21.1 bits), Expect = 0.53, Poisson P(2) = 0.41 Identities = 9/23 (39%), Positives = 11/23 (47%), Frame = +2 Query: 35 EYAHYAKLRKDSEKSSFLAVHWS 57 E +Y LRK E F HW+ Sbjct: 101342 ESENYKTLRKKYENEGFPGYHWA 101410 Score = 44 (20.2 bits), Expect = 1.4, Poisson P(2) = 0.75 Identities = 8/25 (32%), Positives = 15/25 (60%), Frame = +3 Query: 95 LLLSVSYSSNNITAICLAQQTPWKN 119 L++ + S N ++ + L Q PWK+ Sbjct: 151110 LVVVIFLSVNTVSLVILNQN*PWKH 151184 Score = 41 (18.8 bits), Expect = 3.4, Poisson P(2) = 0.97 Identities = 11/30 (36%), Positives = 14/30 (46%), Frame = +1 Query: 7 IDLVEIKRFEQLARQTDNCFAKRLLTSTEY 36 I+ +EI L Q D C KRL + Y Sbjct: 418261 INCLEIHHGLSLFNQFDTCLLKRLGIKSGY 418350 Score = 40 (18.4 bits), Expect = 3.8, Poisson P(2) = 0.98 Identities = 8/15 (53%), Positives = 11/15 (73%), Frame = +2 Query: 32 TSTEYAHYAKLRKDS 46 TSTE+ H+ KL K + Sbjct: 138542 TSTEFPHF*KLIKQA 138586 Minus Strand HSPs: Score = 43 (19.8 bits), Expect = 2.1, Poisson P(2) = 0.87 Identities = 7/13 (53%), Positives = 8/13 (61%), Frame = -1 Query: 56 WSLKEAIYKAVNH 68 W LKE +YK H Sbjct: 481598 WLLKEDVYKLAKH 481560 Score = 43 (19.8 bits), Expect = 2.1, Poisson P(2) = 0.87 Identities = 6/20 (30%), Positives = 13/20 (65%), Frame = -3 Query: 87 CQIDPKIELLLSVSYSSNNI 106 C+++P ++L S Y + N+ Sbjct: 13656 CEVNPNVQLTRSSMYLNTNL 13597 Score = 43 (19.8 bits), Expect = 2.1, Poisson P(2) = 0.87 Identities = 9/24 (37%), Positives = 15/24 (62%), Frame = -3 Query: 77 EITKKNQRYNCQIDPKIELLLSVS 100 +I K + YN ++ PK+ L LS + Sbjct: 511617 KIKKSHLHYNLKMQPKLLLNLSTN 511546 Score = 40 (18.4 bits), Expect = 5.8, Poisson P(3) = 1.0 Identities = 8/14 (57%), Positives = 10/14 (71%), Frame = -1 Query: 60 EAIYKAVNHIKPLF 73 EAIYK HI+ +F Sbjct: 326537 EAIYKRDQHIQTVF 326496 Score = 40 (18.4 bits), Expect = 5.8, Poisson P(3) = 1.0 Identities = 6/16 (37%), Positives = 12/16 (75%), Frame = -2 Query: 95 LLLSVSYSSNNITAIC 110 L++ + ++NNIT +C Sbjct: 132481 LIIKTNLTNNNITFLC 132434 Score = 40 (18.4 bits), Expect = 5.8, Poisson P(3) = 1.0 Identities = 8/16 (50%), Positives = 11/16 (68%), Frame = -3 Query: 93 IELLLSVSYSSNNITA 108 + L S+ +SSNNI A Sbjct: 483615 LNYLTSIFFSSNNINA 483568 Score = 40 (18.4 bits), Expect = 3.8, Poisson P(2) = 0.98 Identities = 12/33 (36%), Positives = 17/33 (51%), Frame = -3 Query: 5 IGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYA 37 IG LV + F+ L NCFAK +S ++ Sbjct: 140919 IGNFLVLMIVFKLLIMSLLNCFAKTFSSSLAFS 140821 Score = 38 (17.5 bits), Expect = 14., Poisson P(4) = 1.0 Identities = 8/21 (38%), Positives = 13/21 (61%), Frame = -3 Query: 63 YKAVNHIKPLFSQLEITKKNQ 83 YKA N + + +QL ++K Q Sbjct: 560883 YKATNIARAMVTQLGMSKLGQ 560821 Score = 38 (17.5 bits), Expect = 4.0, Poisson P(2) = 0.98 Identities = 12/33 (36%), Positives = 18/33 (54%), Frame = -1 Query: 22 TDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAV 54 T+N F LLTS + + AK + +SFL + Sbjct: 315884 TNNWFNIILLTSYKKFNSAKKIRICNSNSFLLI 315786 Parameters: E = 5.0, S = 43 (19.8 bits), E2 = 0.14, S2 = 35 W = 3, T = 13 (6.0 bits), X = 22 (10.1 bits) M = BLOSUM62 C = 0 (Standard genetic code) H = 0, V = 500, B = 250 -gapdecayrate 0.5 (the default) Statistics: Lambda = 0.319, Lambda/ln2 = 0.460, K = 0.132, H = 0.543 bits/position Expected/Observed high score = 45 (20.7 bits) / 215 (98.8 bits) # of letters in query: 119 aa # of neighborhood words in query: 997 # of exact words scoring below T: 5 Database: MGseq # of letters in database: 580,073 bp # of word hits against database: 84,489 # of failed hit extensions: 70,274 # of successful extensions: 236 # of overlapping HSPs discarded: 220 # of HSPs reportable: 16 # of sequences in database: 1 # of db sequences with at least one HSP: 1 No. of states in DFA: 389 (38 KB) Total size of DFA: 50 KB (64 KB) Time to generate neighborhood: 0.00u 0.01s 0.01t Real: 00:00:00 No. of processors used: 1 Time to search database: 1.65u 0.01s 1.66t Real: 00:00:03 Total cpu time: 1.70u 0.13s 1.83t Real: 00:00:03